Available
425
| Name | Value |
|---|---|
| Type | Feed Grade Amino Acids |
| Brand Name | Mychway |
| Place of Origin | India |
| Model Number | MS-12R1 |
| Instrument classification | Class I |
| Warranty | NONE |
| After-sale Service | Online Technical Support |
| Product name | Mycotoxin binder |
| Food Safety Testing | Milk Test Kit |
| Application | animal feed drinking water |
| Testing Time | 5 mins |
| Shelf Life | 12 Months |
| OEM | Unavailable |
| Certificate | CE, ISO |
| Accuracy | 99.5% |
| Storage | 2-8 Degree |
| Test item | Aflatoxin M1 |
| Model number | Botatox 100u |
| dose | 100u |
| product name | botulax |
| 100iu | 60 |
| 200iu | 120 |
| Name | botox |
| Feature | Remove Wrinkle |
| MOQ | 100 |
| Port | Incheon |
| Packaging | Box |
| Lead Time | 5-7 Working Days |
| Keywords | Anti Wrinkle, Liztox |
| 1 | 40 |
| Origin | South Korea |
| Usage | Skin Injectables |
| botox100u | 38$ |
| botox150u | 48$ |
| Certification | CE RoHS |
| Red | The 650nm red light is for wakening and activating the skin |
| Blue | The 462nm blue light is for calming and diminishing inflammation. |
| Green | The 527nm green light is for comforting the skin. |
| Purple | The 600nm purple light is for toxin elimination. |
| Orange | The 610nm light is for Balancing and recomposing. |
| Turquoise | The 470nm turquoise light is for relaxation. |
| Yellow | The 470nm turquoise light is for relaxation. |
| Efficacy | Promote Healthy & Growth, Promote Nutrition, Feed Mycotoxin inhibitor |
| Appearance | Light Brown Powder |
| Grade | Animal Feed Grade |
| Product Keywords | Mycotoxin inhibitor |
ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2
SPECIFICATION OF PSALMOTOXIN 1
|
CAT |
O1120-V |
|
CAS NO. |
/ |
|
Product Name |
Psalmotoxin 1 |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4689.5 Da |
|
Molecular formula |
C200H312N62O57S6 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
APPLICATION OF PSALMOTOXIN 1
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).
As the best peptide company, we provide custom peptide synthesis china, custom peptide synthesis china, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
